PDB entry 1vp2

View 1vp2 on RCSB PDB site
Description: crystal structure of a putative xanthosine triphosphate pyrophosphatase/ham1 protein homolog (tm0159) from thermotoga maritima at 1.78 a resolution
Class: hydrolase
Keywords: putative xanthosine triphosphate pyrophosphatase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, hydrolase
Deposited on 2004-10-06, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.168
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Xanthosine triphosphate pyrophosphatase/HAM1 protein homolog
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0159
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vp2a_
  • Chain 'B':
    Compound: Putative Xanthosine triphosphate pyrophosphatase/HAM1 protein homolog
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0159
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vp2b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vp2A (A:)
    mgsdkihhhhhhmkkltvylattnphkveeikmiapewmeilpspekievvedgetflen
    svkkavvygkklkhpvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkd
    rraafvcsatffdpventlisvedrvegrianeirgtggfgydpffipdgydktfgeiph
    lkekishrskafrklfsvlekilesenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp2A (A:)
    kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
    pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
    ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
    lfsvlekil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vp2B (B:)
    mgsdkihhhhhhmkkltvylattnphkveeikmiapewmeilpspekievvedgetflen
    svkkavvygkklkhpvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkd
    rraafvcsatffdpventlisvedrvegrianeirgtggfgydpffipdgydktfgeiph
    lkekishrskafrklfsvlekilesenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vp2B (B:)
    kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
    pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
    ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
    lfsvlekil