PDB entry 1vov

View 1vov on RCSB PDB site
Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
Class: ribosome
Keywords: 30s ribosomal subunit, protein-RNA complex, protein-protein complex, RNA-RNA complex, ribosome
Deposited on 2004-10-06, released 2004-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 11.5 Å
R-factor: 0.395
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-233)
    Domains in SCOPe 2.06: d1vovb_
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-205)
    Domains in SCOPe 2.06: d1vovc_
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-207)
    Domains in SCOPe 2.06: d1vovd_
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-149)
    Domains in SCOPe 2.06: d1vove_
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-100)
    Domains in SCOPe 2.06: d1vovf_
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-154)
    Domains in SCOPe 2.06: d1vovg_
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-137)
    Domains in SCOPe 2.06: d1vovh_
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-126)
    Domains in SCOPe 2.06: d1vovi_
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-97)
    Domains in SCOPe 2.06: d1vovj_
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-118)
    Domains in SCOPe 2.06: d1vovk_
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-123)
    Domains in SCOPe 2.06: d1vovl_
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-124)
    Domains in SCOPe 2.06: d1vovm_
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-59)
    Domains in SCOPe 2.06: d1vovn_
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-87)
    Domains in SCOPe 2.06: d1vovo_
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-82)
    Domains in SCOPe 2.06: d1vovp_
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-103)
    Domains in SCOPe 2.06: d1vovq_
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-72)
    Domains in SCOPe 2.06: d1vovr_
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-79)
    Domains in SCOPe 2.06: d1vovs_
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-98)
    Domains in SCOPe 2.06: d1vovt_
  • Chain 'a':
    Compound: protein Y
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VOV (0-89)
    Domains in SCOPe 2.06: d1vova_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vovT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vova (a:)
    tmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvl
    vasgkhedmytainelinklerqlnklqhk