PDB entry 1vom

View 1vom on RCSB PDB site
Description: complex between dictyostelium myosin and mgadp and vanadate at 1.9a resolution
Class: muscle protein
Keywords: myosin, molecular motor, transition-state analog, muscle protein
Deposited on 1995-11-09, released 1996-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 1996-12-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • conflict (41)
      • conflict (311)
      • conflict (320-321)
      • conflict (442)
      • conflict (445)
      • conflict (488)
    Domains in SCOP 1.75: d1voma1, d1voma2
  • Heterogens: MG, VO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vomA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vomA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqgvleqqilqanpileafgnakttrnnnssrfgkfiei
    qfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfn
    ylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgage
    gavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkal
    ygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlcinytneklqqffnhh
    mfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlit
    klhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssd
    nvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpa
    kledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapvprdqkatnidpeqy
    rfgitkiffr