PDB entry 1vol

View 1vol on RCSB PDB site
Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
Class: transcription/DNA
Keywords: transcription initiation, molecular recognition, complex, transcription factor, transcription regulation, DNA, transcription/DNA complex
Deposited on 1996-04-29, released 1996-11-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcription factor iib (tfiib))
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00403 (0-203)
      • conflict (21)
      • conflict (30)
      • conflict (32)
    Domains in SCOPe 2.05: d1vola1, d1vola2
  • Chain 'B':
    Compound: protein (tata binding protein (tbp))
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1volb1, d1volb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*tp*g)-3')
    Species:
    Gene:
  • Chain 'D':
    Compound: DNA (5'-d(*cp*ap*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*c)-3')
    Species:
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1volA (A:)
    ammnafkeittmadrinlprnkvdrtnnlfrqayeqkslkgrandaiasaclyiacrqeg
    vprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqmaa
    thiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyrli
    yprapdlfptdfkfdtpvdklpql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1volB (B:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1volB (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrki
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.