PDB entry 1vol

View 1vol on RCSB PDB site
Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
Deposited on 1996-04-29, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1volA (A:)
    ammnafkeittmadrinlprnkvdrtnnlfrqayeqkslkgrandaiasaclyiacrqeg
    vprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqmaa
    thiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyrli
    yprapdlfptdfkfdtpvdklpql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1volB (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrki