PDB entry 1vok

View 1vok on RCSB PDB site
Description: arabidopsis thaliana tbp (dimer)
Class: transcription factor
Keywords: transcription initiation, DNA binding, transcription factor
Deposited on 1996-04-29, released 1996-11-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata-box-binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1voka1, d1voka2
  • Chain 'B':
    Compound: tata-box-binding protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vokb1, d1vokb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vokA (A:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vokA (A:)
    egsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrire
    pkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkf
    pirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafe
    niypvlsefrki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vokB (B:)
    mtdqglegsnpvdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaav
    imrirepkttalifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivg
    scdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrde
    tykafeniypvlsefrkiqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vokB (B:)
    vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
    lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfkiqnivgscdvkfpirle
    glayshaafssyepelfpgliyrmkvpkivllifvsgkivitgakmrdetykafeniypv
    lsefrkiq