PDB entry 1vns

View 1vns on RCSB PDB site
Description: recombinant apo-chloroperoxidase from curvularia inaequalis
Class: haloperoxidase
Keywords: vanadium-containing haloperoxidase, sulphate, recombinant
Deposited on 1999-01-14, released 1999-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanadium chloroperoxidase
    Species: Curvularia inaequalis [TaxId:38902]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49053
      • conflict (543)
    Domains in SCOPe 2.07: d1vnsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vnsA (A:)
    mgsvtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhla
    ihdayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveq
    pnpnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgas
    qegyhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehf
    ladppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtp
    prfynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwr
    plsgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyn
    grvgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsaw
    elmfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgt
    redeeglfpiggvplgieiadeifnnglkptppeiqpmpqetpvqkpvgqqpvkgmweee
    qapvvkeap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vnsA (A:)
    vtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaihd
    ayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpnp
    npganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqeg
    yhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehflad
    ppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtpprf
    ynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpls
    gvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngrv
    gtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawelm
    fenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtred
    eeglfpiggvplgieiadeifnnglkptppeiqp