PDB entry 1vnf

View 1vnf on RCSB PDB site
Description: chloroperoxidase from the fungus curvularia inaequalis: mutant r360a
Class: haloperoxidase
Keywords: vanadium-containing haloperoxidase, oxidoreductase, mutant r360a, haloperoxidase
Deposited on 1999-01-20, released 1999-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanadium chloroperoxidase
    Species: Curvularia inaequalis [TaxId:38902]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49053
      • engineered mutation (359)
      • see remark 999 (543)
    Domains in SCOPe 2.08: d1vnfa_
  • Heterogens: VO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vnfA (A:)
    mgsvtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhla
    ihdayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveq
    pnpnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgas
    qegyhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehf
    ladppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtp
    prfynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwa
    plsgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyn
    grvgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsaw
    elmfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgt
    redeeglfpiggvplgieiadeifnnglkptppeiqpmpqetpvqkpvgqqpvkgmweee
    qapvvkeap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vnfA (A:)
    vtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaihd
    ayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpnp
    npganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqeg
    yhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehflad
    ppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtpprf
    ynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwapls
    gvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngrv
    gtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawelm
    fenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtred
    eeglfpiggvplgieiadeifnnglkptppeiqp