PDB entry 1vnd

View 1vnd on RCSB PDB site
Description: vnd/nk-2 protein (homeodomain), nmr
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1996-05-22, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vnd/nk-2 protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22808 (0-76)
      • conflict (0)
    Domains in SCOPe 2.07: d1vnda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vndA (A:)
    asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
    ryktkraqnekgyeghp