PDB entry 1vnc

View 1vnc on RCSB PDB site
Description: chloroperoxidase from the fungus curvularia inaequalis
Class: oxidoreductase
Keywords: vanadium-containing haloperoxidase, oxidoreductase
Deposited on 1995-09-01, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanadium-containing chloroperoxidase
    Species: Curvularia inaequalis [TaxId:38902]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49053
      • conflict (543)
    Domains in SCOPe 2.06: d1vnca_
  • Heterogens: VO4, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vncA (A:)
    mgsvtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhla
    ihdayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveq
    pnpnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgas
    qegyhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehf
    ladppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtp
    prfynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwr
    plsgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyn
    grvgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsaw
    elmfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgt
    redeeglfpiggvplgieiadeifnnglkptppeiqpmpqetpvqkpvgqqpvkgmweee
    qapvvkeap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vncA (A:)
    svtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaih
    dayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpn
    pnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqe
    gyhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehfla
    dppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtppr
    fynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpl
    sgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngr
    vgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawel
    mfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtre
    deeglfpiggvplgieiadeifnnglkptppeiqpm