PDB entry 1vmp

View 1vmp on RCSB PDB site
Description: structure of the anti-hiv chemokine vmip-II
Class: antiviral protein
Keywords: vmip-II, chemokine, monomer, sarcoma, herpesvirus, hhv-8, kaposi's, antiviral protein
Deposited on 1999-03-25, released 1999-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (anti-hiv chemokine mip vii)
    Species: Human herpesvirus 8 [TaxId:37296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vmpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vmpA (A:)
    lgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
    klmqqlpvtar