PDB entry 1vmk

View 1vmk on RCSB PDB site
Description: Crystal structure of Purine nucleoside phosphorylase (TM1596) from Thermotoga maritima at 2.01 A resolution
Class: transferase
Keywords: TM1596, PURINE NUCLEOSIDE PHOSPHORYLASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-09-30, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmka_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmkb_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1596
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmkc_
  • Heterogens: MG, GUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmkA (A:)
    mgsdkihhhhhhmmkkieeartfisertnlspdiliilgsgfgpfiekvedpviidykdi
    phfpqptveghsgklvfgrisdkpvmimagrfhlyeghdpatvafpvylakyvgvkgvvv
    tnaagainpefkpgeiilvrdiinfmfrnplrgpndekigprfpdmssvvdpewarkiqe
    rlslkegvyigvlgpsyetpaeirvfeklgadlvgmstvpeviaakhcglkvvvfscvtn
    maagithgrlsheevvrttkmaqgkiekalttavevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmkA (A:)
    mmkkieeartfisertnlspdiliilggpfiekvedpviidykdiphfpgklvfgrisdk
    pvmimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefkpgeiilvrdii
    nfmfrnplrgpndekigprfpdmssvvdpewarkiqerlslkegvyigvlgpsyetpaei
    rvfeklgadlvgmstvpeviaakhcglkvvvfscvtnmaagisheevvrttkmaqgkiek
    alttavevf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vmkB (B:)
    mgsdkihhhhhhmmkkieeartfisertnlspdiliilgsgfgpfiekvedpviidykdi
    phfpqptveghsgklvfgrisdkpvmimagrfhlyeghdpatvafpvylakyvgvkgvvv
    tnaagainpefkpgeiilvrdiinfmfrnplrgpndekigprfpdmssvvdpewarkiqe
    rlslkegvyigvlgpsyetpaeirvfeklgadlvgmstvpeviaakhcglkvvvfscvtn
    maagithgrlsheevvrttkmaqgkiekalttavevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmkB (B:)
    mmkkieeartfisertnlspdiliilgsgpfiekvedpviidykdiphfpgklvfgrisd
    kpvmimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefkpgeiilvrdi
    infmfrnplrgpndekigprfpdmssvvdpewarkiqerlslkegvyigvlgpsyetpae
    irvfeklgadlvgmstvpeviaakhcglkvvvfscvtnmaagisheevvrttkmaqgkie
    kalttavevf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vmkC (C:)
    mgsdkihhhhhhmmkkieeartfisertnlspdiliilgsgfgpfiekvedpviidykdi
    phfpqptveghsgklvfgrisdkpvmimagrfhlyeghdpatvafpvylakyvgvkgvvv
    tnaagainpefkpgeiilvrdiinfmfrnplrgpndekigprfpdmssvvdpewarkiqe
    rlslkegvyigvlgpsyetpaeirvfeklgadlvgmstvpeviaakhcglkvvvfscvtn
    maagithgrlsheevvrttkmaqgkiekalttavevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmkC (C:)
    mmkkieeartfisertnlspdiliilgfiekvedpviidykdiphfpgklvfgrisdkpv
    mimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefkpgeiilvrdiinf
    mfrnplrgpndekigprfpdmssvvdpewarkiqerlslkegvyigvlgpsyetpaeirv
    feklgadlvgmstvpeviaakhcglkvvvfscvtnmaagitttkmaqgkiekalttavev
    f