PDB entry 1vmj

View 1vmj on RCSB PDB site
Description: crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution
Class: transferase
Keywords: putative thiamin phosphate synthase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, transferase
Deposited on 2004-09-30, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.145
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0723
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0723
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vmja_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmjA (A:)
    mgsdkihhhhhhmksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhita
    svfinddepglhhdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitd
    rkmdlgpweqvfygefdgmrpkrvlvkiige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmjA (A:)
    mksyrkelwfhtkrrrefinitplleecvresgikeglllcnamhitasvfinddepglh
    hdfevwleklapekpysqykhndtgednadahlkrtimgrevviaitdrkmdlgpweqvf
    ygefdgmrpkrvlvkiige