PDB entry 1vmi

View 1vmi on RCSB PDB site
Description: Crystal structure of Putative phosphate acetyltransferase (np_416953.1) from Escherichia coli k12 at 2.32 A resolution
Class: transferase
Keywords: np_416953.1, Putative phosphate acetyltransferase, structural genomics, JCSG, protein structure initiative, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-09-28, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphate acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: eutD, eutI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77218 (13-End)
      • see remark 999 (6-12)
      • modified residue (73)
      • modified residue (87)
      • modified residue (116)
      • modified residue (121)
      • modified residue (164)
      • modified residue (212)
      • modified residue (276)
      • modified residue (311)
    Domains in SCOPe 2.08: d1vmia1, d1vmia2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmiA (A:)
    hhhhhhtdpalraiiercrelalraparvvfpdaldqrvlkaaqylhqqglatpilvanp
    felrqfalshgvamdglqvidphgnlamreefahrwlaragektppdalekltdplmfaa
    amvsagkadvciagnlsstanvlraglriiglqpgcktlssiflmlpqysgpalgfadcs
    vvpqptaaqladialasaetwraitgeeprvamlsfssngsarhpcvanvqqateivrer
    apklvvdgelqfdaafvpevaaqkapasplqgkanvmvfpsleagnigykiaqrlggyra
    vgpliqglaapmhdlsrgcsvqeiielalvaavprqtevnresslqtlveglcgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmiA (A:)
    tdpalraiiercrelalraparvvfpdaldqrvlkaaqylhqqglatpilvanpfelrqf
    alshgvamdglqvidphgnlamreefahrwlaragektppdalekltdplmfaaamvsag
    kadvciagnlsstanvlraglriiglqpgcktlssiflmlpqysgpalgfadcsvvpqpt
    aaqladialasaetwraitgeeprvamlsfssngsarhpcvanvqqateivrerapklvv
    dgelqfdaafvpevaaqkapasplqgkanvmvfpsleagnigykiaqrlggyravgpliq
    glaapmhdlsrgcsvqeiielalvaavpr