PDB entry 1vmh

View 1vmh on RCSB PDB site
Description: Crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 A resolution
Class: unknown function
Keywords: Yjbq-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2004-09-24, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.159
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized conserved protein YjbQ/UPF0047 family, ortholog yugU B.subtilis
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC0907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vmha_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmhA (A:)
    mgsdkihhhhhhmkgvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttag
    itinenadpdvtrdilvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklkl
    gtwqgiyftefdgprdrkvfvkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmhA (A:)
    vieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrdi
    lvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefdgpr
    drkvfvkii