PDB entry 1vmg

View 1vmg on RCSB PDB site
Description: Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution
Class: Hydrolase
Keywords: 13816655, MazG nucleotide pyrophosphohydrolase, Structural Genomics, JCSG, Protein Structure Initiative, PSI, Joint Center for Structural Genomics, Hydrolase
Deposited on 2004-09-24, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.142
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein SSO3215
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97U11 (Start-94)
      • modified residue (12)
      • modified residue (23)
      • modified residue (26)
    Domains in SCOPe 2.08: d1vmga_
  • Heterogens: LI, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmgA (A:)
    mgsdkihhhhhhmdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnl
    dsiqeeladviawtvsianlegidieealkkkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmgA (A:)
    mdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnldsiqeeladvia
    wtvsianlegidieealkkkykl