PDB entry 1vme

View 1vme on RCSB PDB site
Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution
Class: electron transport
Keywords: TM0755, FLAVOPROTEIN, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, ELECTRON TRANSPORT
Deposited on 2004-09-21, released 2004-09-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavoprotein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZL4 (12-409)
      • expression tag (8-11)
      • modified residue (12)
      • modified residue (157)
      • modified residue (167)
      • modified residue (274)
      • modified residue (282)
      • modified residue (337)
      • modified residue (392)
    Domains in SCOPe 2.02: d1vmea1, d1vmea2
  • Chain 'B':
    Compound: Flavoprotein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0755
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZL4 (12-409)
      • expression tag (10-11)
      • modified residue (12)
      • modified residue (157)
      • modified residue (167)
      • modified residue (274)
      • modified residue (282)
      • modified residue (337)
      • modified residue (392)
    Domains in SCOPe 2.02: d1vmeb1, d1vmeb2
  • Heterogens: CL, FEO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmeA (A:)
    mgsdkihhhhhhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvkln
    ganvlidgwkgnyakefidalskivdpkeithiivnhtepdhsgslpatlktighdveii
    asnfgkrllegfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscd
    vgggyllpeilddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpgh
    gliwkkdpqrllnhyvsvakgdpkkgkvtviydsmygfvenvmkkaidslkekgftpvvy
    kfsdeerpaiseilkdipdsealifgvstyeaeihplmrftlleiidkanyekpvlvfgv
    hgwapsaertagellketkfrilsfteikgsnmderkieeaisllkkele
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmeA (A:)
    hhhhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidg
    wkgnyakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrl
    legfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllp
    eilddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdp
    qrllnhyvsvakgdpkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerp
    aiseilkdipdsealifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsae
    rtagellketkfrilsfteikgsnmderkieeaisllkkele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vmeB (B:)
    mgsdkihhhhhhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvkln
    ganvlidgwkgnyakefidalskivdpkeithiivnhtepdhsgslpatlktighdveii
    asnfgkrllegfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscd
    vgggyllpeilddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpgh
    gliwkkdpqrllnhyvsvakgdpkkgkvtviydsmygfvenvmkkaidslkekgftpvvy
    kfsdeerpaiseilkdipdsealifgvstyeaeihplmrftlleiidkanyekpvlvfgv
    hgwapsaertagellketkfrilsfteikgsnmderkieeaisllkkele
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmeB (B:)
    hhmpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwk
    gnyakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrlle
    gfygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpei
    lddsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqr
    llnhyvsvakgdpkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpai
    seilkdipdsealifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaert
    agellketkfrilsfteikgsnmderkieeaisllkkele