PDB entry 1vmd

View 1vmd on RCSB PDB site
Description: Crystal structure of Methylglyoxal synthase (TM1185) from Thermotoga maritima at 2.06 A resolution
Class: lyase
Keywords: TM1185, METHYLGLYOXAL SYNTHASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, LYASE
Deposited on 2004-09-20, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.17
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylglyoxal synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: mgsA,TM1185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0R7 (23-End)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1vmda1, d1vmda2
  • Chain 'B':
    Compound: methylglyoxal synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: mgsA,TM1185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0R7 (23-End)
      • cloning artifact (16-22)
    Domains in SCOPe 2.07: d1vmdb1, d1vmdb2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmdA (A:)
    mgsdkihhhhhhmsdrprrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelya
    tgttgallqeklglkvhrlksgplggdqqigamiaegkidvliffwdplepqahdvdvka
    liriatvynipvaitrstadflissplmndvyekiqidyeeelerrirkvvegeeeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmdA (A:)
    prrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelyatgttgallqeklglkv
    hrlksgplggdqqigamiaegkidvliffwdplepqahdvdvkaliriatvynipvaitr
    stadflissplmndvyekiqidyeeelerrirkvve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vmdB (B:)
    mgsdkihhhhhhmsdrprrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelya
    tgttgallqeklglkvhrlksgplggdqqigamiaegkidvliffwdplepqahdvdvka
    liriatvynipvaitrstadflissplmndvyekiqidyeeelerrirkvvegeeeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmdB (B:)
    prrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelyatgttgallqeklglkv
    hrlksgplggdqqigamiaegkidvliffwdplepqahdvdvkaliriatvynipvaitr
    stadflissplmndvyekiqidyeeelerrirkvve