PDB entry 1vmc

View 1vmc on RCSB PDB site
Description: stroma cell-derived factor-1alpha (sdf-1alpha)
Class: cytokine
Keywords: cxc-chemokine
Deposited on 2004-09-20, released 2005-03-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stromal cell-derived factor 1
    Species: HOMO SAPIENS
    Gene: CXCL12, SDF1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vmca1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmcA (A:)
    sdykpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkw
    iqeylekalnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmcA (A:)
    rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekaln
    k