PDB entry 1vmc

View 1vmc on RCSB PDB site
Description: stroma cell-derived factor-1alpha (sdf-1alpha)
Class: cytokine
Keywords: cxc-chemokine, cytokine
Deposited on 2004-09-20, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: 0.46
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmcA (A:)
    sdykpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkw
    iqeylekalnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmcA (A:)
    rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekaln
    k