PDB entry 1vmb

View 1vmb on RCSB PDB site
Description: Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution
Class: translation
Keywords: TM0603, 30S RIBOSOMAL PROTEIN S6, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSLATION
Deposited on 2004-09-16, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rpsF,TM0603
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vmba_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vmbA (A:)
    mgsdkihhhhhhmayvkeriyesmfiiapnvpeeerenlvervkkiieervkgkidkver
    mgmrkfayeikkfnegdytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerk
    aqrekaaaeatesseggsed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vmbA (A:)
    keriyesmfiiapnvpeeerenlvervkkiieervkgkidkvermgmrkfayeikkfneg
    dytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerkaqr