PDB entry 1vm9

View 1vm9 on RCSB PDB site
Description: the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Deposited on 2004-09-13, released 2004-09-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vm9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vm9A (A:)
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs

    Sequence, based on observed residues (ATOM records): (download) 
    >1vm9A (A:)
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka