PDB entry 1vm9

View 1vm9 on RCSB PDB site
Description: The X-ray Structure of the cys84ala cys85ala double mutant of the [2Fe-2S] Ferredoxin subunit of Toluene-4-Monooxygenase from Pseudomonas Mendocina KR1
Class: electron transport
Keywords: STRUCTURAL GENOMICS, CESG, PROTEIN STRUCTURE INITIATIVE, PSI, FERREDOXIN, FES, [2FE-2S] CLUSTER, RIESKE PROTEIN, TOLUENE-4-MONOOXYGENASE SUBUNIT, Center for Eukaryotic Structural Genomics, ELECTRON TRANSPORT
Deposited on 2004-09-13, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene-4-monooxygenase system protein C
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Gene: tmoC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00458 (0-End)
      • engineered (82-83)
    Domains in SCOPe 2.07: d1vm9a_
  • Heterogens: MG, FES, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm9A (A:)
    sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
    itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm9A (A:)
    sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
    itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka