PDB entry 1vm8

View 1vm8 on RCSB PDB site
Description: Crystal structure of UDP-N-acetylglucosamine pyrophosphorylase (Agx2) from Mus musculus at 2.50 A resolution
Class: transferase
Keywords: Agx2, 16741099, UDP-N-acetylglucosamine pyrophosphorylase, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-09-10, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91YN5
      • see remark 999 (42)
      • modified residue (46)
      • modified residue (51)
      • modified residue (80)
      • modified residue (135)
      • modified residue (176)
      • modified residue (182)
      • modified residue (209)
      • modified residue (213)
      • modified residue (229)
      • modified residue (250)
      • modified residue (389)
      • modified residue (437)
    Domains in SCOPe 2.07: d1vm8a_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91YN5
      • see remark 999 (42)
      • modified residue (46)
      • modified residue (51)
      • modified residue (80)
      • modified residue (135)
      • modified residue (176)
      • modified residue (182)
      • modified residue (209)
      • modified residue (213)
      • modified residue (229)
      • modified residue (250)
      • modified residue (389)
      • modified residue (437)
    Domains in SCOPe 2.07: d1vm8b_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm8A (A:)
    mgsdkihhhhhhmnvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsf
    frkaigefdrsshqekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlll
    aggqgtrlgvsypkgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsg
    rtmestkefftkhkffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyr
    alaaqnivedmeqrgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptep
    vgvvcrvdgvyqvveyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepq
    lqhhvaqkkipyvdsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplkn
    adsqngkdnpttarhalmslhhcwvlnagghfidengsrlpaiprsatngkseaitadvn
    hnlkdandvpiqceisplisyageglegyvadkefhapliidengvhelvkngi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm8A (A:)
    nvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsffrkaigefdrssh
    qekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlllaggqgtrlgvsyp
    kgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsgrtmestkefftkh
    kffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeq
    rgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqv
    veyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepqlqhhvaqkkipyv
    dsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsqgkdnpttar
    halmslhhcwvlnagghfidengsrlpaipvpiqceisplisyageglegyvadkefhap
    liidengvhel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vm8B (B:)
    mgsdkihhhhhhmnvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsf
    frkaigefdrsshqekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlll
    aggqgtrlgvsypkgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsg
    rtmestkefftkhkffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyr
    alaaqnivedmeqrgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptep
    vgvvcrvdgvyqvveyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepq
    lqhhvaqkkipyvdsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplkn
    adsqngkdnpttarhalmslhhcwvlnagghfidengsrlpaiprsatngkseaitadvn
    hnlkdandvpiqceisplisyageglegyvadkefhapliidengvhelvkngi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm8B (B:)
    nvndlkqrlsqagqehllqfwnelseaqqmelymelqamnfeelnsffrkaigefdrssh
    qekvdarmepvprqvlgsatrdqeqlqaweseglsqisqnkvavlllaggqgtrlgvsyp
    kgmydvglpshktlfqiqaerilklqqlaekhhgnkctipwyimtsgrtmestkefftkh
    kffglkkenvvffqqgmlpamsfdgkiileeknkvsmapdgngglyralaaqnivedmeq
    rgicsihvycvdnilvkvadprfigfciqkgadcgakvvektnptepvgvvcrvdgvyqv
    veyseislataqrrssdgrllfnagnianhfftvpflkdvvnvyepqlqhhvaqkkipyv
    dsqgyfikpdkpngikmekfvfdifqfakkfvvyevlredefsplknadsgkdnpttarh
    almslhhcwvlnagghfidengsrlpaiprvpiqceisplisyageglegyvadkefhap
    liidengvhe