PDB entry 1vm7

View 1vm7 on RCSB PDB site
Description: Crystal structure of Ribokinase (TM0960) from Thermotoga maritima at 2.15 A resolution
Class: transferase
Keywords: TM0960, RIBOKINASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-09-08, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribokinase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vm7a_
  • Chain 'B':
    Compound: ribokinase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vm7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm7A (A:)
    mgsdkihhhhhhmflvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavt
    vakigekgcrfvtcignddysdllienyeklgitgyirvslptgrafievdktgqnriii
    fpganaelkkelidwntlsesdilllqneipfettlecakrfngivifdpapaqgineei
    fqyldyltpnekeiealskdffgefltvekaaekflelgvknvivklgdkgvllvnknek
    khfptfkvkavdttaagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipa
    reeveaflknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm7A (A:)
    mflvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavtvakigekgcrfv
    tcignddysdllienyeklgitgyirvslptgrafievdktgqnriiifpganaelkkel
    idwntlsesdilllqneipfettlecakrfngivifdpapaqgineeifqyldyltpnek
    eiealskdffgefltvekaaekflelgvknvivklgdkgvllvnknekkhfptfkvkavd
    ttaagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipareeveaflknl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vm7B (B:)
    mgsdkihhhhhhmflvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavt
    vakigekgcrfvtcignddysdllienyeklgitgyirvslptgrafievdktgqnriii
    fpganaelkkelidwntlsesdilllqneipfettlecakrfngivifdpapaqgineei
    fqyldyltpnekeiealskdffgefltvekaaekflelgvknvivklgdkgvllvnknek
    khfptfkvkavdttaagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipa
    reeveaflknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm7B (B:)
    flvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavtvakigekgcrfvt
    cignddysdllienyeklgitgyirvslptgrafievdktgqnriiifpganaelkkeli
    dwntlsesdilllqneipfettlecakrfngivifdpapaqgineeifqyldyltpneke
    iealskdffgefltvekaaekflelgvknvivklgdkgvllvnknekkhfptfkvkavdt
    taagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipareeveaflkn