PDB entry 1vm6

View 1vm6 on RCSB PDB site
Description: Crystal structure of Dihydrodipicolinate reductase (TM1520) from Thermotoga maritima at 2.27 A resolution
Class: oxidoreductase
Keywords: TM1520, DIHYDRODIPICOLINATE REDUCTASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-09-03, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: dapB, TM1520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1K8 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vm6a2, d1vm6a3, d1vm6a4
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: dapB, TM1520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1K8 (12-End)
      • leader sequence (7-11)
    Domains in SCOPe 2.07: d1vm6b1, d1vm6b2, d1vm6b3
  • Chain 'C':
    Compound: dihydrodipicolinate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: dapB, TM1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vm6c2, d1vm6c3
  • Chain 'D':
    Compound: dihydrodipicolinate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: dapB, TM1520
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1K8 (12-End)
      • leader sequence (8-11)
    Domains in SCOPe 2.07: d1vm6d1, d1vm6d2, d1vm6d3
  • Heterogens: ACT, NAD, PG4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm6A (A:)
    mgsdkihhhhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidf
    sspealpktvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrf
    lselvkvledwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvf
    gnigetieikhraisrtvfaigalkaaeflvgkdpgmysfeevifgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm6A (A:)
    hmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealpktvd
    lckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrflselvkvledw
    dveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvfgnigetieikh
    raisrtvfaigalkaaeflvgkdpgmysfeevifg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vm6B (B:)
    mgsdkihhhhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidf
    sspealpktvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrf
    lselvkvledwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvf
    gnigetieikhraisrtvfaigalkaaeflvgkdpgmysfeevifgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm6B (B:)
    hhhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealp
    ktvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrflselvkv
    ledwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvfgnigeti
    eikhraisrtvfaigalkaaeflvgkdpgmysfeevif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vm6C (C:)
    mgsdkihhhhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidf
    sspealpktvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrf
    lselvkvledwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvf
    gnigetieikhraisrtvfaigalkaaeflvgkdpgmysfeevifgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm6C (C:)
    mkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealpktvdl
    ckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrflselvkvledwd
    veivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvfgnigetieikhr
    aisrtvfaigalkaaeflvgkdpgmysfeevifgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vm6D (D:)
    mgsdkihhhhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidf
    sspealpktvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrf
    lselvkvledwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvf
    gnigetieikhraisrtvfaigalkaaeflvgkdpgmysfeevifgge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm6D (D:)
    hhhhmkygivgysgrmgqeiqkvfsekghelvlkvdvngveeldspdvvidfsspealpk
    tvdlckkyraglvlgttalkeehlqmlrelskevpvvqaynfsiginvlkrflselvkvl
    edwdveivethhrfkkdapsgtaillesalgksvpihslrvggvpgdhvvvfgnigetie
    ikhraisrtvfaigalkaaeflvgkdpgmysfeevif