PDB entry 1vm0

View 1vm0 on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at2g34160
Deposited on 2004-08-24, released 2004-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vm0a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vm0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm0A (A:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm0A (A:)
    kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
    imtsivdikpvqkakieitlvksekfdelmaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vm0B (B:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm0B (B:)
    knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
    mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke