PDB entry 1vm0

View 1vm0 on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at2g34160
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, CESG, At2g34160, Unknown Function, Nitrate, PSI, Center for Eukaryotic Structural Genomics
Deposited on 2004-08-24, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g34160
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22969
      • modified residue (42)
      • modified residue (55)
      • modified residue (79)
      • engineered (82)
      • modified residue (113)
    Domains in SCOPe 2.07: d1vm0a_
  • Chain 'B':
    Compound: unknown protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g34160
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22969
      • modified residue (42)
      • modified residue (55)
      • modified residue (79)
      • engineered (82)
      • modified residue (113)
    Domains in SCOPe 2.07: d1vm0b_
  • Heterogens: K, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vm0A (A:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm0A (A:)
    kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
    imtsivdikpvqkakieitlvksekfdelmaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vm0B (B:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vm0B (B:)
    knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
    mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke