PDB entry 1vlz

View 1vlz on RCSB PDB site
Description: uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey
Class: signal transduction protein
Keywords: chey, response regulators, two-component systems, signal transduction protein
Deposited on 1995-04-21, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • conflict (85)
    Domains in SCOPe 2.07: d1vlza_
  • Chain 'B':
    Compound: chey
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-127)
      • conflict (85)
    Domains in SCOPe 2.07: d1vlzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlzA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlzB (B:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlzB (B:)
    dkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
    mdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleeklnk
    ifeklgm