PDB entry 1vly

View 1vly on RCSB PDB site
Description: Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 A resolution
Class: transferase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, transferase
Deposited on 2004-08-20, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.136
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unknown protein from 2D-page
    Species: Escherichia coli [TaxId:562]
    Gene: ygfZ, b2898
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39179
      • modified residue (33)
      • modified residue (52)
      • modified residue (63)
      • modified residue (80)
      • modified residue (183)
      • modified residue (245)
      • modified residue (280)
      • modified residue (307)
      • modified residue (311)
    Domains in SCOPe 2.07: d1vlya1, d1vlya2
  • Heterogens: ACT, CA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlyA (A:)
    mgsdkihhhhhhmaftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtad
    vsqmaedqhllaahcdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvt
    iapddervllgvagfqaraalanlfselpskekqvvkegattllwfehpaerflivtdea
    tanmltdklrgeaelnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgc
    ytgqemvarakfrgankralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledg
    qvvvqvvmnndmepdsifrvrddantlhieplpyslee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlyA (A:)
    ftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhllaah
    cdakgkmwsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgvag
    fqaraalanlfselpskekqvvkegattllwfehpaerflivtdeatanmltdklrgeae
    lnnsqqwlalnieagfpvidaansgqfipqatnlqalggisfkkgcytgqemvarakfrg
    ankralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmep
    dsifrvrddantlhieplpysle