PDB entry 1vlw

View 1vlw on RCSB PDB site
Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution
Deposited on 2004-08-18, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vlwa_
  • Chain 'B':
    Domains in SCOP 1.69: d1vlwb_
  • Chain 'C':
    Domains in SCOP 1.69: d1vlwc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlwA (A:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwA (A:)
    hhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsfl
    kekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelv
    kamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvg
    salvkgtpdevrekakafvekirgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlwB (B:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwB (B:)
    hhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsf
    lkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptel
    vkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgv
    gsalvkgtpdevrekakafvekirgct
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlwC (C:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwC (C:)
    hmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflk
    ekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvk
    amklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgs
    alvkgtpdevrekakafvekirgc