PDB entry 1vlu

View 1vlu on RCSB PDB site
Description: Crystal structure of Gamma-glutamyl phosphate reductase (yor323c) from Saccharomyces cerevisiae at 2.40 A resolution
Class: oxidoreductase
Keywords: yor323c, GAMMA-GLUTAMYL PHOSPHATE REDUCTASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-08-16, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyl phosphate reductase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PRO2, YOR323C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54885 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (90)
      • modified residue (109)
      • modified residue (169)
      • modified residue (272)
      • modified residue (383)
    Domains in SCOPe 2.07: d1vlua1, d1vlua2
  • Chain 'B':
    Compound: Gamma-glutamyl phosphate reductase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PRO2, YOR323C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54885 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (90)
      • modified residue (109)
      • modified residue (169)
      • modified residue (272)
      • modified residue (383)
    Domains in SCOPe 2.07: d1vlub1, d1vlub2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vluA (A:)
    mgsdkihhhhhhmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieean
    kidlavaketgladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltl
    yqvtapvgvllvifesrpevianitalsiksgnaailkggkesvntfremakivndtiaq
    fqsetgvpvgsvqlietrqdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadg
    icsiyldedadlikakrisldaktnypagcnametllinpkfskwwevlenltleggvti
    hatkdlktayfdklnelgklteaiqcktvdadeeqdfdkeflsldlaakfvtstesaiqh
    inthssrhtdaivtenkanaekfmkgvdssgvywnastrfadgfrygfgaevgistskih
    argpvgldglvsyqyqirgdgqvasdylgaggnkafvhkdldiktvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vluA (A:)
    hmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketg
    ladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvll
    vifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgs
    vqlietrvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedadli
    kakrisldaktncnametllinpkfskwwevlenltleggvtihatkdlktayfdklnel
    gklteaiqcktvsldlaakfvtstesaiqhinthssrhtdaivtenkanaekfmkgvdss
    gvywnastrfadvgldglvsyqyqirgdgqvasdy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vluB (B:)
    mgsdkihhhhhhmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieean
    kidlavaketgladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltl
    yqvtapvgvllvifesrpevianitalsiksgnaailkggkesvntfremakivndtiaq
    fqsetgvpvgsvqlietrqdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadg
    icsiyldedadlikakrisldaktnypagcnametllinpkfskwwevlenltleggvti
    hatkdlktayfdklnelgklteaiqcktvdadeeqdfdkeflsldlaakfvtstesaiqh
    inthssrhtdaivtenkanaekfmkgvdssgvywnastrfadgfrygfgaevgistskih
    argpvgldglvsyqyqirgdgqvasdylgaggnkafvhkdldiktvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vluB (B:)
    hmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketg
    ladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvll
    vifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgs
    vqlietdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedadli
    kakrisldaktnnametllinpkfskwwevlenltleggvtihatkdlktayfdklnelg
    klteaiqcktvdadsldlaakfvtstesaiqhinthssrhtdaivtenkanaekfmkgvd
    ssgvywnastrfadggldglvsyqyqirgdgqvasdy