PDB entry 1vlt

View 1vlt on RCSB PDB site
Description: ligand binding domain of the wild-type aspartate receptor with aspartate
Class: complex (chemotaxis/peptide)
Keywords: complex (chemotaxis/peptide), chemotaxis, bacterial chemotaxis receptor, bound
Deposited on 1996-09-17, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate receptor
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vlta_
  • Chain 'B':
    Compound: aspartate receptor
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vltb_
  • Heterogens: ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vltA (A:)
    mnqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnak
    ttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqpt
    qgmqnalgealgnyarvsenlyrqtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vltA (A:)
    gfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnakttla
    qaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqptqgmq
    nalgealgnyarvsenlyrqtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vltB (B:)
    mnqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnak
    ttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqpt
    qgmqnalgealgnyarvsenlyrqtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vltB (B:)
    qgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnakttl
    aqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqptqgm
    qnalgealgnyarvsenlyrqtf