PDB entry 1vls

View 1vls on RCSB PDB site
Description: ligand binding domain of the wild-type aspartate receptor
Class: chemotaxis
Keywords: chemotaxis, bacterial chemotaxis receptor, unbound
Deposited on 1996-09-17, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate receptor
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlsA (A:)
    mnqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnak
    ttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqpt
    qgmqnalgealgnyarvsenlyrqtf