PDB entry 1vlr

View 1vlr on RCSB PDB site
Description: Crystal structure of mRNA decapping enzyme (DcpS) from Mus musculus at 1.83 A resolution
Class: RNA binding protein
Keywords: 16740816, mRNA decapping enzyme (DcpS), STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, RNA BINDING PROTEIN
Deposited on 2004-08-10, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA decapping enzyme
    Species: Mus musculus [TaxId:10090]
    Gene: DCPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlra1, d1vlra2
  • Chain 'B':
    Compound: mRNA decapping enzyme
    Species: Mus musculus [TaxId:10090]
    Gene: DCPS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlrb1, d1vlrb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlrA (A:)
    mgsdkihhhhhhmadtapqlkrkreqeaeeaetpsteekeagvgngtsapvrlpfsgfrv
    qkvlresardkiiflhgkvnedsgdthgedavvilektpfqvehvaqlltgspelklqfs
    ndiystynlfpprhlsdikttvvypatekhlqkymrqdlrliretgddyrtitlpylesq
    slsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirs
    lrdltpehlpllrnilregqeailkryqvtgdrlrvylhylpsyyhlhvhftalgfeapg
    sgverahllaqvienlecdpkhyqqrtltfalrtddpllqllqkaqqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlrA (A:)
    pvrlpfsgfrvqkvlresardkiiflhgkvnegedavvilektpfqvehvaqlltgspel
    klqfsndiystynlfpprhlsdikttvvypatekhlqkymrqdlrliretgddyrtitlp
    ylesqslsiqwvynildkdrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgir
    slrdltpehlpllrnilregqeailkryqvtgdrlrvylhylpsyyhlhvhftalgfeap
    gsgverahllaqvienlecdpkhyqqrtltfalrtddpllqllqkaqqer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlrB (B:)
    mgsdkihhhhhhmadtapqlkrkreqeaeeaetpsteekeagvgngtsapvrlpfsgfrv
    qkvlresardkiiflhgkvnedsgdthgedavvilektpfqvehvaqlltgspelklqfs
    ndiystynlfpprhlsdikttvvypatekhlqkymrqdlrliretgddyrtitlpylesq
    slsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgirs
    lrdltpehlpllrnilregqeailkryqvtgdrlrvylhylpsyyhlhvhftalgfeapg
    sgverahllaqvienlecdpkhyqqrtltfalrtddpllqllqkaqqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlrB (B:)
    vrlpfsgfrvqkvlresardkiiflhgkvneedavvilektpfqvehvaqlltgspelkl
    qfsndiystynlfpprhlsdikttvvypatekhlqkymrqdlrliretgddyrtitlpyl
    esqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrg
    irslrdltpehlpllrnilregqeailkryqvtgdrlrvylhylpsyyhlhvhftalgfe
    apgsgverahllaqvienlecdpkhyqqrtltfalrtddpllqllqkaqqer