PDB entry 1vlq

View 1vlq on RCSB PDB site
Description: Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution
Class: hydrolase
Keywords: TM0077, ACETYL XYLAN ESTERASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-08-09, released 2004-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqa_
  • Chain 'B':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqb_
  • Chain 'C':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqc_
  • Chain 'D':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqd_
  • Chain 'E':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqe_
  • Chain 'F':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqf_
  • Chain 'G':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqg_
  • Chain 'H':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqh_
  • Chain 'I':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqi_
  • Chain 'J':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqj_
  • Chain 'K':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlqk_
  • Chain 'L':
    Compound: acetyl xylan esterase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2
      • modified residue (58)
      • modified residue (119)
      • modified residue (126)
      • modified residue (156)
      • modified residue (284)
    Domains in SCOPe 2.06: d1vlql_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlqA (A:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqA (A:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlqB (B:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqB (B:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlqC (C:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqC (C:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlqD (D:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqD (D:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vlqE (E:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqE (E:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vlqF (F:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqF (F:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vlqG (G:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqG (G:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vlqH (H:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqH (H:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vlqI (I:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqI (I:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vlqJ (J:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqJ (J:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vlqK (K:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqK (K:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vlqL (L:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthp
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlqL (L:)
    affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
    sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
    sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
    iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
    keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
    nhegggsfqaveqvkflkklfe