PDB entry 1vlp

View 1vlp on RCSB PDB site
Description: Crystal structure of a putative nicotinate phosphoribosyltransferase (yor209c, npt1) from saccharomyces cerevisiae at 1.75 A resolution
Class: transferase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, transferase
Deposited on 2004-08-06, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPT1, YOR209C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39683 (12-End)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (25)
      • modified residue (30)
      • modified residue (203)
      • modified residue (207)
      • modified residue (247)
      • modified residue (264)
      • modified residue (358)
      • modified residue (410)
    Domains in SCOPe 2.08: d1vlpa1, d1vlpa2, d1vlpa3
  • Chain 'B':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPT1, YOR209C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39683 (12-End)
      • modified residue (12)
      • modified residue (25)
      • modified residue (30)
      • modified residue (203)
      • modified residue (207)
      • modified residue (247)
      • modified residue (264)
      • modified residue (358)
      • modified residue (410)
    Domains in SCOPe 2.08: d1vlpb1, d1vlpb2
  • Chain 'C':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPT1, YOR209C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39683 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (25)
      • modified residue (30)
      • modified residue (203)
      • modified residue (207)
      • modified residue (247)
      • modified residue (264)
      • modified residue (358)
      • modified residue (410)
    Domains in SCOPe 2.08: d1vlpc1, d1vlpc2, d1vlpc3
  • Chain 'D':
    Compound: Nicotinate phosphoribosyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NPT1, YOR209C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39683 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (25)
      • modified residue (30)
      • modified residue (203)
      • modified residue (207)
      • modified residue (247)
      • modified residue (264)
      • modified residue (358)
      • modified residue (410)
    Domains in SCOPe 2.08: d1vlpd1, d1vlpd2, d1vlpd3
  • Heterogens: PO4, CL, MES, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlpA (A:)
    mgsdkihhhhhhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnke
    ainwlkeqfsylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseei
    egkpthyklkilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlf
    dngirfsefgtrrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpig
    tvahewvmgvasisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysd
    ayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengml
    atfgigtnftndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrv
    keelgyterswsgdneahrwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlpA (A:)
    hhhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnkeainwlkeqf
    sylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseeiegkpthykl
    kilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlfdngirfsef
    gtrrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpigtvahewvmg
    vasisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysdayvgvrqds
    gdpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengmlatfgigtnf
    tndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrvkeelgyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlpB (B:)
    mgsdkihhhhhhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnke
    ainwlkeqfsylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseei
    egkpthyklkilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlf
    dngirfsefgtrrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpig
    tvahewvmgvasisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysd
    ayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengml
    atfgigtnftndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrv
    keelgyterswsgdneahrwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlpB (B:)
    msepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnkeainwlkeqfsyl
    gnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseeiegkpthyklkil
    vsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlfdngirfsefgtr
    rrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpigtvahewvmgvas
    isedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysdayvgvrqdsgdp
    veytkkishhyhdvlklpkfskiicysdslnvekaityshaakengmlatfgigtnftnd
    frkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrvkeelgytersw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlpC (C:)
    mgsdkihhhhhhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnke
    ainwlkeqfsylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseei
    egkpthyklkilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlf
    dngirfsefgtrrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpig
    tvahewvmgvasisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysd
    ayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengml
    atfgigtnftndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrv
    keelgyterswsgdneahrwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlpC (C:)
    hhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnkeainwlkeqfs
    ylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseeiegkpthyklk
    ilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlfdngirfsefg
    trrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpigtvahewvmgv
    asisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysdayvgvrqdsg
    dpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengmlatfgigtnft
    ndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrvkeelgyte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlpD (D:)
    mgsdkihhhhhhmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnke
    ainwlkeqfsylgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseei
    egkpthyklkilvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlf
    dngirfsefgtrrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpig
    tvahewvmgvasisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysd
    ayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengml
    atfgigtnftndfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrv
    keelgyterswsgdneahrwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlpD (D:)
    hmsepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnkeainwlkeqfsy
    lgnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseeiegkpthyklki
    lvsgswkdtilyeipllsliseayfkfvdidwdyenqleqaekkaetlfdngirfsefgt
    rrrrslkaqdlimqgimkavngnpdrnkslllgtsnilfakkygvkpigtvahewvmgva
    sisedylhanknamdcwintfgaknaglaltdtfgtddflksfrppysdayvgvrqdsgd
    pveytkkishhyhdvlklpkfskiicysdslnvekaityshaakengmlatfgigtnftn
    dfrkksepqvkseplnivikllevngnhaikisdnlgknmgdpatvkrvkeelgyt