PDB entry 1vlo

View 1vlo on RCSB PDB site
Description: Crystal structure of aminomethyltransferase (T protein; tetrahydrofolate-dependent) of glycine cleavage system (np417381) from Escherichia coli k12 at 1.70 A resolution
Class: transferase
Keywords: np417381, aminomethyltransferase (T protein; tetrahydrofolate-dependent) of glycine cleavage system, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-08-05, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: gcvT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27248 (Start-374)
      • modified residue (29)
      • modified residue (36)
      • modified residue (57)
      • modified residue (63)
      • modified residue (99)
      • modified residue (155)
      • modified residue (182)
      • modified residue (244)
      • modified residue (251)
      • modified residue (262)
      • modified residue (297)
      • modified residue (358)
      • see remark 999 (376-378)
    Domains in SCOPe 2.07: d1vloa1, d1vloa2, d1vloa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vloA (A:)
    hhhhhhtdpalraaqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfd
    vshmtivdlrgsrtreflryllandvakltksgkalysgmlnasggviddlivyyftedf
    frlvvnsatrekdlswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqav
    egmkpffgvqagdlfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlr
    leagmnlygqemdetisplaanmgwtiawepadrdfigrealevqrehgteklvglvmte
    kgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegigetaivqirnremp
    vkvtkpvfvrngkavaglcgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vloA (A:)
    qtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsrtr
    eflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekdls
    witqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagdlf
    iattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemdet
    isplaanmgwtiawepadrdfigrealevqrehgteklvglvmtekgvlrnelpvrftda
    qgnqhegiitsgtfsptlgysialarvpegigetaivqirnrempvkvtkpvfvrngkav
    aglc