PDB entry 1vlm

View 1vlm on RCSB PDB site
Description: Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution
Class: transferase
Keywords: TM1293, SAM-DEPENDENT METHYLTRANSFERASE, POSSIBLE HISTAMINE N-METHYLTRANSFERASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-08-04, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM-dependent methyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X119 (12-218)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (76)
      • modified residue (107)
      • modified residue (171)
      • modified residue (174)
    Domains in SCOPe 2.07: d1vlma1, d1vlma2
  • Chain 'B':
    Compound: SAM-dependent methyltransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X119 (12-218)
      • modified residue (12)
      • modified residue (76)
      • modified residue (107)
      • modified residue (171)
      • modified residue (174)
    Domains in SCOPe 2.07: d1vlmb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlmA (A:)
    mgsdkihhhhhhmwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgr
    favplkikigvepsermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddper
    alkeayrilkkggylivgivdresflgreyeknkeksvfyknarffsteelmdlmrkagf
    eefkvvqtlfkhpselseiepvkegygegafvvirgtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlmA (A:)
    hmwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgrfavplkikigv
    epsermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddperalkeayrilkk
    ggylivgivdresflgreyeknkekvfyknarffsteelmdlmrkagfeefkvvqtlfkh
    pselseiepvkegygegafvvirgtkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlmB (B:)
    mgsdkihhhhhhmwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgr
    favplkikigvepsermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddper
    alkeayrilkkggylivgivdresflgreyeknkeksvfyknarffsteelmdlmrkagf
    eefkvvqtlfkhpselseiepvkegygegafvvirgtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlmB (B:)
    mwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgrfavplkikigve
    psermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddperalkeayrilkkg
    gylivgivdresflgreyeknkeksvfyknarffsteelmdlmrkagfeefkvvqtlfkh
    pselseiepvkegygegafvvirgtkk