PDB entry 1vll

View 1vll on RCSB PDB site
Description: Crystal structure of alanine dehydrogenase (AF1665) from Archaeoglobus fulgidus at 2.80 A resolution
Deposited on 2004-08-03, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vlla_
  • Chain 'B':
    Domains in SCOP 1.69: d1vllb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vllA (A:)
    mgsdkihhhhhhmetliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefek
    gdlrampahlmgyaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslr
    tgaaggiaakylarknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvs
    ycedrgisasvqpaeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldv
    eilkkakivvddleqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitif
    dstglaiqdvavakvvyenalsknvgskikffri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vllA (A:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikffr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vllB (B:)
    mgsdkihhhhhhmetliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefek
    gdlrampahlmgyaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslr
    tgaaggiaakylarknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvs
    ycedrgisasvqpaeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldv
    eilkkakivvddleqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitif
    dstglaiqdvavakvvyenalsknvgskikffri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vllB (B:)
    metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
    yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
    arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
    paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
    leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
    akvvyenalsknvgskikffr