PDB entry 1vlk

View 1vlk on RCSB PDB site
Description: structure of viral interleukin-10
Class: cytokine
Keywords: cytokine, glycoprotein
Deposited on 1997-02-14, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral interleukin-10
    Species: Human herpesvirus 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlkA (A:)
    qcdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfyle
    evmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqek
    giykamsefdifinyieaymtikar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlkA (A:)
    cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
    vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
    iykamsefdifinyieaymtik