PDB entry 1vli

View 1vli on RCSB PDB site
Description: Crystal structure of Spore coat polysaccharide biosynthesis protein spsE (BSU37870) from Bacillus subtilis at 2.38 A resolution
Class: biosynthetic protein
Keywords: 2636322, SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, BSU37870, SPSE, PSI, Joint Center for Structural Genomics, BIOSYNTHETIC PROTEIN
Deposited on 2004-07-27, released 2004-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spore coat polysaccharide biosynthesis protein spsE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spsE, ipa-67d
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39625
      • modified residue (64)
      • modified residue (70)
      • modified residue (95)
      • modified residue (97)
      • modified residue (160)
      • modified residue (190)
      • modified residue (210)
      • modified residue (271)
    Domains in SCOPe 2.03: d1vlia1, d1vlia2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vliA (A:)
    mgsdkihhhhhhmaafqianktvgkdapvfiiaeaginhdgkldqafalidaaaeagada
    vkfqmfqadrmyqkdpglyktaagkdvsifslvqsmempaewilplldycrekqviflst
    vcdegsadllqstspsafkiasyeinhlpllkyvarlnrpmifstagaeisdvheawrti
    raegnnqiaimhcvakypappeysnlsvipmlaaafpeavigfsdhsehpteapcaavrl
    gakliekhftidknlpgadhsfalnpdelkemvdgirkteaelkqgitkpvsekllgssy
    ktttaiegeirnfayrgifttapiqkgeafsedniavlrpgqkpqglhprffelltsgvr
    avrdipadtgivwddillkdspfhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vliA (A:)
    aafqianktvgkdapvfiiaeaginhdgkldqafalidaaaeagadavkfqmfqadrmyq
    kdpdvsifslvqsmempaewilplldycrekqviflstvcdegsadllqstspsafkias
    yeinhlpllkyvarlnrpmifstagaeisdvheawrtiraegnnqiaimhcvakypappe
    ysnlsvipmlaaafpeavigfsdhsehpteapcaavrlgakliekhftidknlpgadhsf
    alnpdelkemvdgirkteaelkqgitkpvsekllgssyktttaiegeirnfayrgiftta
    piqkgeafsedniavlrpgqkpqglhprffelltsgvravrdipadtgivwddillkd