PDB entry 1vlh

View 1vlh on RCSB PDB site
Description: Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution
Class: transferase
Keywords: TM0741, PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-07-23, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlha_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlhb_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlhc_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlhd_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlhe_
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: coaD, kdtB, TM0741
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlhf_
  • Heterogens: PNS, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlhA (A:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhA (A:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlhB (B:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhB (B:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlhC (C:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhC (C:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlhD (D:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhD (D:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vlhE (E:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhE (E:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vlhF (F:)
    mgsdkihhhhhhmkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftlee
    rkklieevlsdldgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankkly
    sdletvfliasekfsfissslvkevalyggdvtewvppevaralneklkegkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlhF (F:)
    mkavypgsfdpitlghvdiikralsifdelvvlvtenprkkcmftleerkklieevlsdl
    dgvkvdvhhgllvdylkkhgikvlvrglravtdyeyelqmalankklysdletvfliase
    kfsfissslvkevalyggdvtewvppevaralneklk