PDB entry 1vlg

View 1vlg on RCSB PDB site
Description: Crystal structure of Ferritin (TM1128) from Thermotoga maritima at 2.00 A resolution
Class: metal binding protein
Keywords: TM1128, FERRITIN, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, METAL BINDING PROTEIN
Deposited on 2004-07-23, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlga_
  • Chain 'B':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgb_
  • Chain 'C':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgc_
  • Chain 'D':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgd_
  • Chain 'E':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlge_
  • Chain 'F':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgf_
  • Chain 'G':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgg_
  • Chain 'H':
    Compound: Ferritin
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1128
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vlgh_
  • Heterogens: FE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlgA (A:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgA (A:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlgB (B:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgB (B:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlgC (C:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgC (C:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlgD (D:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgD (D:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vlgE (E:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgE (E:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vlgF (F:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgF (F:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vlgG (G:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgG (G:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vlgH (H:)
    mgsdkihhhhhhmmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkq
    aqeelthamkfyeyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynile
    laseekdhatvsflkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlgH (H:)
    mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
    eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
    flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre