PDB entry 1vlf

View 1vlf on RCSB PDB site
Description:
Deposited on 2004-07-22, released 2004-08-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfm1, d1vlfm2
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfn1, d1vlfn2
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfo1, d1vlfo2
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfp1, d1vlfp2
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfq1, d1vlfq2
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfr1, d1vlfr2
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfs1, d1vlfs2
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlft1, d1vlft2
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfu1, d1vlfu2
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfv1, d1vlfv2
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfw1, d1vlfw2
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vlfx1, d1vlfx2

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfM (M:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfN (N:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfO (O:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfP (P:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfQ (Q:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfR (R:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfS (S:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfT (T:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfU (U:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfV (V:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfW (W:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlfX (X:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl