PDB entry 1vle

View 1vle on RCSB PDB site
Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
Deposited on 2004-07-22, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleM (M:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleN (N:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleO (O:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleP (P:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleQ (Q:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleR (R:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleS (S:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleT (T:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleU (U:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleV (V:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleW (W:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vleX (X:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl