PDB entry 1vlc

View 1vlc on RCSB PDB site
Description: Crystal structure of 3-isopropylmalate dehydrogenase (TM0556) from Thermotoga maritima at 1.90 A resolution
Class: dehydrogenase
Keywords: TM0556, 3-ISOPROPYLMALATE DEHYDROGENASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, DEHYDROGENASE
Deposited on 2004-07-20, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: leuB, TM0556
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ26 (12-365)
      • leader sequence (4-11)
    Domains in SCOPe 2.07: d1vlca1, d1vlca2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlcA (A:)
    mgsdkihhhhhhmkiavlpgdgigpevvrealkvlevvekktgktfekvfghiggdaidr
    fgeplpeetkkicleadaiflgsvggpkwddlppekrpeiggllalrkmlnlyanirpik
    vyrslvhvsplkekvigsgvdlvtvrelsygvyygqprgldeekgfdtmiydrktveria
    rtafeiaknrrkkvtsvdkanvlyssmlwrkvvnevareypdvelthiyvdnaamqlilk
    psqfdvilttnmfgdilsdesaalpgslgllpsasfgdknlyepaggsapdiagknianp
    iaqilslammlehsfgmveearkieravelvieegyrtrdiaedpekavstsqmgdlick
    kleeiw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlcA (A:)
    kihhhhhhmkiavlpgdgigpevvrealkvlevvekktgktfekvfghiggdaidrfgep
    lpeetkkicleadaiflgsvggpkwddlppekrpeiggllalrkmlnlyanirpikvyrs
    lvhvsplkekvigsgvdlvtvrelsygvyygqprgldeekgfdtmiydrktveriartaf
    eiaknrrkkvtsvdkanvlyssmlwrkvvnevareypdvelthiyvdnaamqlilkpsqf
    dvilttnmfgdilsdesaalpgslgllpsasfgdknlyepaggsapdiagknianpiaqi
    lslammlehsfgmveearkieravelvieegyrtrdiaedpekavstsqmgdlickklee
    iw