PDB entry 1vlb

View 1vlb on RCSB PDB site
Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
Class: Oxidoreductase
Keywords: Aldehyde Oxidoreductase; Desulfovibrio Gigas; iron-sulphur cluster
Deposited on 2004-07-20, released 2004-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.148
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde oxidoreductase
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1vlba1, d1vlba2, d1vlba3, d1vlba4
  • Heterogens: CL, MG, PCD, FES, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vlbA (A:)
    miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
    vtkmkrvadgaqittiegvgqpenlhplqkawvlhggaqcgfcspgfivsakglldtnad
    psredvrdwfqkhrnacrctgykplvdavmdaaavingkkpetdlefkmpadgriwgsky
    prptavakvtgtldygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvi
    thkdvkgknritglitfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekv
    kvdleelpaymsgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyv
    grqphmpiepdvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggt
    fgykfsptsealvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllam
    esdwlvdhgpysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqs
    mfaseclmdmlaeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaal
    ekaqkestathkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadig
    cvgtahealrpmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkace
    kpgggyytydelkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdva
    tgqttvdgmtlmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpf
    ikqipdkldivyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypek
    vlealka