PDB entry 1vla

View 1vla on RCSB PDB site
Description: Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
Class: oxidoreductase
Keywords: TM0919, HYDROPEROXIDE RESISTANCE PROTEIN OSMC, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-07-15, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroperoxide resistance protein OsmC
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X021 (12-149)
      • leader sequence (6-11)
      • modified residue (12)
      • modified residue (20-21)
      • modified residue (34)
      • modified residue (58)
      • modified residue (63)
      • modified residue (72)
      • modified residue (78)
    Domains in SCOPe 2.07: d1vlaa1, d1vlaa2
  • Chain 'B':
    Compound: Hydroperoxide resistance protein OsmC
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X021 (12-149)
      • leader sequence (8-11)
      • modified residue (12)
      • modified residue (20-21)
      • modified residue (34)
      • modified residue (58)
      • modified residue (63)
      • modified residue (72)
      • modified residue (78)
    Domains in SCOPe 2.07: d1vlab1, d1vlab2
  • Chain 'C':
    Compound: Hydroperoxide resistance protein OsmC
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X021 (12-149)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (20-21)
      • modified residue (34)
      • modified residue (58)
      • modified residue (63)
      • modified residue (72)
      • modified residue (78)
    Domains in SCOPe 2.07: d1vlac1, d1vlac2
  • Chain 'D':
    Compound: Hydroperoxide resistance protein OsmC
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X021 (12-End)
      • modified residue (12)
      • modified residue (20-21)
      • modified residue (34)
      • modified residue (58)
      • modified residue (63)
      • modified residue (72)
      • modified residue (78)
    Domains in SCOPe 2.07: d1vlad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlaA (A:)
    mgsdkihhhhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmg
    ctgmdvvsilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvek
    avqlsqekycsvsailkcsskvtyeivyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlaA (A:)
    hhhhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdv
    vsilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsq
    ekycsvsailkcsskvtyeivyen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlaB (B:)
    mgsdkihhhhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmg
    ctgmdvvsilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvek
    avqlsqekycsvsailkcsskvtyeivyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlaB (B:)
    hhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvs
    ilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqek
    ycsvsailkcsskvtyeivyen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlaC (C:)
    mgsdkihhhhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmg
    ctgmdvvsilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvek
    avqlsqekycsvsailkcsskvtyeivyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlaC (C:)
    hhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsil
    rkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekyc
    svsailkcsskvtyeivyen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vlaD (D:)
    mgsdkihhhhhhmqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmg
    ctgmdvvsilrkmkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvek
    avqlsqekycsvsailkcsskvtyeivyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlaD (D:)
    mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrk
    mkvidqmkdfrieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsv
    sailkcsskvtyeivye