PDB entry 1vl9

View 1vl9 on RCSB PDB site
Description: Atomic resolution (0.97A) structure of the triple mutant (K53,56,121M) of bovine pancreatic phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, Calcium ion, HYDROLASE
Deposited on 2004-07-15, released 2004-10-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.114
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Gene: PLA2G1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
    • engineered (120)
  Domains in SCOPe 2.05: d1vl9a_
• Heterogens: CA, CL, MRD, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vl9A (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  mnc